Metadata-Version: 2.1
Name: predict-phytolrr
Version: 1.0.2
Summary: A tool which predict phyto-LRRs from a sequences.
Home-page: https://github.com/phytolrr/predict-phytolrr
Author: PhytoLRR
Author-email: phytolrr@163.com
License: UNKNOWN
Description: # An overview to the predict-phytolrr program
        
        The `predict-phytolrr` program could identify LRRs effectively, especially for **LRR motifs in plant LRR-RLKs**.
        
        The program is based on the position specific scoring matrix (PSSM) algorithm and its training dataset are 4000 LRR motifs highly conserved sequences (HCSs) from LRR-RLKs of 17 land plant species. Please find detailed information at [https://www.phytolrr.com/about](https://www.phytolrr.com/about).
        
        # Citation for Phyto-LRR
        If the corresponding features in the `predict-phytolrr` program were applied for your analysis, please cite the following paper:
        
        Chen, T. Identification and characterization of the LRR repeats in plant LRR-RLKs. BMC Mol and Cell Biol 22, 9 (2021). https://doi.org/10.1186/s12860-021-00344-y
        
        # Install the program
        
        `predict-phytolrr` can be installed using `pip` **ONLY** under Python3 environment:
        
        ```bash
        $ pip install predict-phytolrr
        ``` 
        
        A virtual environment(virtutalenv e.g.) is recommended to prevent the damage of the system-wide Python environment.
        
        # Run the program
        
        You can run the program in two ways:
        
        * run predict-phytolrr from the command line
        * import the phytolrr_predictor module in the python source code
        
        ## Predict Plant LRRs from the command line
        
        The `predict-phytolrr` could accept sequence(s) in either directly input from the command line or in fasta file(s), predict the LRRs, and print out the results either in the command line or in html files.
        
        ### Two ways to feed the sequences
        
        **First way:** The sequence can be written directly through the *command line*:
        ```bash
        $ predict-phytolrr MKLPHLLPFLTLILFAFAFSMTLPLMSESHLSLLNNRTDQQ....(very long)
        Prediction result for seq Unknown_from_cmd_line:
        LRR offset 8, FLTLILFAFAFSMTLP, score 5.68619738546084
        LRR offset 81, VTYLNLTHTGLQGTLT, score 17.662632191299593
        LRR offset 105, LRVLALRNNSLQGSIP, score 36.37469484306763
        LRR offset 129, LQVLRVSQNQLEGKIP, score 35.079609050990754
        LRR offset 153, LQRLILSYNRLEGSIP, score 39.13663517011341
        ... many other results followed
        ```
        
        **Second way:** The sequences can also be read from fasta files. Assuming the file `test.fasta` contains one or more sequences, to predict LRRs for all the sequences in the file, use the `-f` option to specify a fasta file:
        
        ```bash
        $ predict-phytolrr -f test.fasta
        The sequence AL3G49070.t1 contains unexpected amino *, will not be predicted
        The sequence AL3G41990.t1 contains unexpected amino *, will not be predicted
        The sequence AL8G14250.t1 contains unexpected amino *, will not be predicted
        Prediction result for seq AL5G26370.t1:
        LRR offset 82, VTGVDLGGLKLTGVVS, score 20.609043937370146
        LRR offset 106, LRSLNLADNFFRGAIP, score 33.523950081875626
        LRR offset 130, LQYLNMSNNFLGGVIP, score 34.2935452040218
        LRR offset 154, LSTLDLSSNHLEQGVP, score 29.383744295363456
        LRR offset 178, LVILSLGRNNLTGKFP, score 34.567366699698404
        ... other predicted LRRs for seq AL5G26370.t1
        
        Prediction result for seq AL5G26330.t1:
        LRR offset 74, VTRLDLGGLQLGGVIS, score 24.76974498840441
        LRR offset 98, LISLNLYDNSFGGTIP, score 34.4857875432728
        LRR offset 122, LQHLNMSYNFLGGGIP, score 31.754313744552327
        LRR offset 146, LLELDLISNHLGHCVP, score 10.059227438374975
        
        ... many other results followed
        ```
        
        More than one fasta files could also be accepted by using the `-f` option for each fasta file:
        
        ```bash
        $ predict-phytolrr -f test1.fasta -f test2.fasta
        
        ... all prediction results for all sequences in test1.fasta and test2.fasta
        ```
        
        ### NOTE
        
        1. Sequences with undefined amino acids read from fasta files, for instance "X", "*", will be skipped in the prediction process.
        2. The asterisk "*" at the end of the fasta sequence will be removed automatically during the prediction process.
        
        ### To display the results in html
        
        The result can also be dumped to HTML files, so that they can be viewed in a browser. Using the `-p` option to specify the root path of the resulting HTML files:
        
        ```bash
        $ predict-phytolrr -f test1.fasta -p ./
        Warning: The sequence AL3G49070.t1 contains unexpected amino *, will not be predicted
        Warning: The sequence AL3G41990.t1 contains unexpected amino *, will not be predicted
        Warning: The sequence AL8G14250.t1 contains unexpected amino *, will not be predicted
        214 sequences were predicted and the results have been saved in the file results.html
        
        ```
        
        The program will generate two files:
        
        * `results.js` to save the prediction results
        * `results.html` to show the prediction results
        
        ### To specify a self-defined training dataset(motifs)
        
        If you have some motifs, and you want to predict LRRs based on the PSSM matrix which is generated by the motifs,
        you can use the option `-t`/`--train-motifs-file` to specify a path to a file which contains self-defined training-motifs.
        The training-motifs-file should contains multiple motifs, and each motif per line with the same length. 
        The motifs length is not necessary to be 16. For example, the content of the training-motifs-file may like:
        
        ```
        LEVLFLHGNQL
        VTYLNLTHTGL
        LQIFSIGGCHI
        LKLLHLHHNFV
        (More motifs follow)
        ```
        
        The length of the predicted motifs will be of the same length with the motifs of the training dataset. 
        
        ## Predict Phyto LRRs in source code
        
        The `predict-phytolrr` also provides an API interface, so that it can be easily integrated into other python projects.
        
        To use `predict-phtolrr` to predict phyto-LRRs, just import `phytolrr_predictor` and call `predict`, which is defined as:
        
        ```python
        def predict(seq, matrix=None):
            """Predict motifs from the `seq` str. If the `matrix` is None, using the built-in matrix to predict motifs"""
        ```
        
        Code example:
        
        ```commandline
        >>> import phytolrr_predictor
        >>> test_seq = 'MGILFFLFALTLTLSSLSSSVFGLTQDGEALLEMKRGLNDTKGLLSNWKDTDINPCNWTRISCHLHDQRVRVINLPFLRLGGTISPSIGKITRLHRLAIH'
        >>> ms = phytolrr_predictor.predict(test_seq)
        >>> print(len(ms))
        2
        >>> print(ms[0].offset)                             # Print the offset of the first predicted motif 
        6
        >>> print(test_seq[ms[0].offset:ms[0].offset+16])   # Print the first predicted motif
        LFALTLTLSSLSSSVF
        >>> print(ms[0].score)
        10.774822491308072
        >>> print(ms[0].probability)
        0.0005707622379645206
        >>> print(ms[0].fdr_probability)
        0.04882352941176471
        ```
        
        To use self-defined matrix to predict motifs, the matrix should be generated using function `pssm_matrix.calc_pssm_matrix`:
        
        ```python
        def calc_pssm_matrix(motif_seqs_str):
            """Generate the PSSM matrix from baseline motifs `motif_seqs_str`"""
        ```
        
        Code example:
        
        ```commandline
        >>> import phytolrr_predictor
        >>> from phytolrr_predictor.tools import pssm_matrix
        >>> baseline = [
        'LEVLFLHGNQLENDPY',
        'VTYLNLTHTGLQGTLT',
        'LQIFSIGGCHIKGSIP', ....]
        >>> matrix = pssm_matrix.calc_pssm_matrix(baseline)
        >>> ms = phytolrr_predictor.predict(test_seq, matrix)
        # other operations...
        ```
Platform: UNKNOWN
Classifier: License :: OSI Approved :: GNU General Public License v3 (GPLv3)
Classifier: Development Status :: 4 - Beta
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python :: 3
Requires-Python: >=3.6
Description-Content-Type: text/markdown
